Transcript | Ll_transcript_180235 |
---|---|
CDS coordinates | 1271-1879 (+) |
Peptide sequence | MTLLNCLLSAWYGLPFVSPDNILVSTINGTGAVIEIIYVLIFIIFAPRKQKAKILGLFISVLVVFSIVVFVSLFALHGNPRKLFCGFAAAVFSIIMYGSPLSIMRVVIRTKSVEFMPFFLSLFVFLCGTSWFVFGLLGRDPFVAVPNGVGSALGAVQLILYFIYRDNKGAPKKQPPPEEESIEMDHTKTNGEKQCNANEIQK* |
ORF Type | complete |
Blastp | Bidirectional sugar transporter SWEET1 from Arabidopsis with 72.92% of identity |
---|---|
Blastx | Bidirectional sugar transporter SWEET1 from Arabidopsis with 74.18% of identity |
Eggnog | sugar transporter(ENOG4111M4R) |
Kegg | Link to kegg annotations (AT1G21460) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414412.1) |
Pfam | Sugar efflux transporter for intercellular exchange (PF03083.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer