Transcript | Ll_transcript_530984 |
---|---|
CDS coordinates | 13-333 (+) |
Peptide sequence | MPSTRLYAKGRVTGHKRGKRNVRTHTSLIQIEGVANKEEAQFYLGKRIAYVYTAQKEIGGSKVRIIWGKVTRSHGNNGMVRSKFRQNLPPKAFGHSVRIMLYPSNI* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | 60S ribosomal protein L33-B from Saccharomyces with 65.38% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YOR234C) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433313.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer