Protein coding transcript 167799

• Transcript: Ll_transcript_179906
• CDS coordinates: 216-1025 (+)
• Peptide sequence: MHSLSMEPPHISISTMIPTASWFTPKRLLGIFCMINMLNYLDRGAIASNGVNGSKGTCTKPGICTSGTGIQGDFNLNNFEDGILSSAFMVGLLVASPIFASLAKSVNPFRLIGVGLSVWTVATLCCGLSFNFWSISVCRMLVGVGEASFISLAAPFIDDNAPVSQKTAWLSIFYMCIPTGYALGYVYGGLVGTYFGWRYAFWVESILMLPFAIFGFFVKPLQLKGFIPANSEKTPALETAVSGVQDEPLSLAEFRDQSSNGHFRSKSETK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_179906

• Blastp: Probable sphingolipid transporter spinster homolog 2 from Arabidopsis with 72.81% of identity
• Blastx: Probable sphingolipid transporter spinster homolog 2 from Arabidopsis with 72.81% of identity
• Eggnog: major facilitator Superfamily(COG0477)
• Kegg: Link to kegg annotations (AT5G64500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418645.1)
• Pfam: Sugar (and other) transporter (PF00083.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;