Protein coding transcript 167803

• Transcript: Ll_transcript_179911
• CDS coordinates: 1997-2815 (+)
• Peptide sequence: MLPFAIFGFFVKPLQLKGFIPANSEKTPALETAVSGVQDEPLSLAEFRDQSSNGHFRSKSETKIFDQFSRLKNDMTALLLNKIYVVNVLGYIAYTFVLGAYSYWGPKVGYNIYHMTNADLVFGGITIVCGIIGTLAGGFVLDFMTNTLSNAFKLLSIATFIGGAFCFGAFLFKSMYGFLVLFSIGELLVFATQGPVNYVCLHCVEPSLRPLSMAMSTVAIHIFGDVPSSPLVGILQDNINNWRMTTLILTAILFPAAGIWFIGKSSCYLSLL*
• ORF Type: complete

Annotations of Ll_transcript_179911

• Blastp: Probable sphingolipid transporter spinster homolog 3 from Arabidopsis with 61.36% of identity
• Blastx: Probable sphingolipid transporter spinster homolog 3 from Arabidopsis with 61.57% of identity
• Eggnog: major facilitator Superfamily(COG0477)
• Kegg: Link to kegg annotations (AT2G22730)
• CantataDB: Link to cantataDB annotations (CNT0002309)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418646.1)
• Pfam: Organic Anion Transporter Polypeptide (OATP) family (PF03137.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;