Transcript | Ll_transcript_179896 |
---|---|
CDS coordinates | 216-812 (+) |
Peptide sequence | MHSLSMEPPHISISTMIPTASWFTPKRLLGIFCMINMLNYLDRGAIASNGVNGSKGTCTKPGICTSGTGIQGDFNLNNFEDGILSSAFMVGLLVASPIFASLAKSVNPFRLIGVGLSVWTVATLCCGLSFNFWSISVCRMLVGVGEASFISLAAPFIDDNAPVSQVCFFVSFVGCPFSAKPSLSRRPLYSQALFDPTT* |
ORF Type | complete |
Blastp | Probable sphingolipid transporter spinster homolog 2 from Arabidopsis with 75% of identity |
---|---|
Blastx | Probable sphingolipid transporter spinster homolog 2 from Arabidopsis with 75% of identity |
Eggnog | major facilitator Superfamily(COG0477) |
Kegg | Link to kegg annotations (AT5G64500) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418646.1) |
Pfam | Major Facilitator Superfamily (PF07690.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer