Protein coding transcript 167811

• Transcript: Ll_transcript_179902
• CDS coordinates: 883-1509 (+)
• Peptide sequence: MVGLLVASPIFASLAKSVNPFRLIGVGLSVWTVATLCCGLSFNFWSISVCRMLVGVGEASFISLAAPFIDDNAPVSQKTAWLSIFYMCIPTGYALGYVYGGLVGTYFGWRYAFWVESILMLPFAIFGFFVKPLQLKGFIPANSEKTPALETAVSGVQDEPLSLAEFRDQSSNGHFRSKSETKIFDQFSRLKNDMTALLLNKIYVVNVLG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_179902

• Blastp: Probable sphingolipid transporter spinster homolog 2 from Arabidopsis with 59.81% of identity
• Blastx: Probable sphingolipid transporter spinster homolog 2 from Arabidopsis with 61.23% of identity
• Eggnog: major facilitator Superfamily(COG0477)
• Kegg: Link to kegg annotations (AT5G64500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418645.1)
• Pfam: Major Facilitator Superfamily (PF07690.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;