Protein coding transcript 16785

• Transcript: Ll_transcript_276333
• CDS coordinates: 794-1114 (+)
• Peptide sequence: MKHVLHIVLSKYLGYMNLFNVQFNHYMIFHDRHQELGYKITQGDEVEDMFNLLCEVKRQIPSVNAVSSGAIASDYQRLRVESVCSRLGFVSLAYLWRQDQSLLLQEM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_276333

• Blastp: Diphthine--ammonia ligase from Saccharomyces with 60.27% of identity
• Blastx: Diphthine--ammonia ligase from Rattus with 69.23% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YLR143W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421815.1)
• Pfam: Diphthamide synthase (PF01902.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;