Protein coding transcript 16790

• Transcript: Ll_transcript_276353
• CDS coordinates: 997-1350 (+)
• Peptide sequence: MYSALQNCISMPWKPTIKTAEEKLVVLLCIQSVYSLLGVVSLFQVELIDPAVKGTLNVLKSCVKSPSVKRVILTSSMAAVVHNGRSRTPDVIIDETWFSNLDICRELKSWYAFGKTSA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_276353

• Blastp: Tetraketide alpha-pyrone reductase 1 from Arabidopsis with 42.67% of identity
• Blastx: Dihydroflavonol 4-reductase from Dianthus with 39.04% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (AT4G35420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412687.1)
• Pfam: 3-beta hydroxysteroid dehydrogenase/isomerase family (PF01073.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;