Protein coding transcript 16791

• Transcript: Ll_transcript_276354
• CDS coordinates: 867-1385 (+)
• Peptide sequence: MSTCEGKLVCVTGASGYIASWIVKFLLQRGYTVRATVRDPSNVKKIEHLVNLDGANERLHLFKADLLEQGSFDSAIEGCHGVFHTASPVIAAVNVQDPQVELIDPAVKGTLNVLKSCVKSPSVKRVILTSSMAAVVHNGRSRTPDVIIDETWFSNLDICRELKSWYAFGKTSA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_276354

• Blastp: Tetraketide alpha-pyrone reductase 1 from Arabidopsis with 53.76% of identity
• Blastx: Tetraketide alpha-pyrone reductase 1 from Arabidopsis with 53.76% of identity
• Eggnog: Nad-dependent epimerase dehydratase(COG0451)
• Kegg: Link to kegg annotations (AT4G35420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412687.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;