Protein coding transcript 167918

• Transcript: Ll_transcript_182467
• CDS coordinates: 980-1552 (+)
• Peptide sequence: MAMNHFTWIYFFFSREKDAETRDFVNAAKVCLEICRSFGVPLLINDRIDVALACDADGVHVGQSDMPTRLARSLLGPEKIIGVSCKTPEQAEQAWIDGADYIGCGGVYPTNTKANNRTIGLDGLREICQASKLPVVAIGGIGLSNAGVVMESVPNLKGVAVVSALFDRECVLTETRNLHAIIREAVLSRK*
• ORF Type: complete

Annotations of Ll_transcript_182467

• Blastp: Thiamine biosynthetic bifunctional enzyme TH1, chloroplastic from Arabidopsis with 77.33% of identity
• Blastx: Thiamine biosynthetic bifunctional enzyme TH1, chloroplastic from Arabidopsis with 77.33% of identity
• Eggnog: phosphomethylpyrimidine kinase(COG0351)
• Kegg: Link to kegg annotations (AT1G22940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426094.1)
• Pfam: Thiamine monophosphate synthase (PF02581.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;