Protein coding transcript 167926

• Transcript: Ll_transcript_182466
• CDS coordinates: 120-677 (+)
• Peptide sequence: MAFSLYSLQVAPLVSRQDRNSSFLSQNSDSNQKNKMHVSMAMQMDEASTNLHIFHNKVPHVLTVAGSDSGSGAGIQADLKACAAHRVYCSTVITAVTAQNTVGVQGVNIMPEDFVAEQLRSVLSDMHVDVVKTGMLPSLNILKVLCQNLREFPVKALVVDPVMVSTSGHVLVGPSILDGFRYVFF*
• ORF Type: complete

Annotations of Ll_transcript_182466

• Blastp: Thiamine biosynthetic bifunctional enzyme TH1, chloroplastic from Arabidopsis with 73.81% of identity
• Blastx: Thiamine biosynthetic bifunctional enzyme TH1, chloroplastic from Arabidopsis with 73.81% of identity
• Eggnog: phosphomethylpyrimidine kinase(COG0351)
• Kegg: Link to kegg annotations (AT1G22940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426094.1)
• Pfam: Phosphomethylpyrimidine kinase (PF08543.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;