Transcript | Ll_transcript_182466 |
---|---|
CDS coordinates | 120-677 (+) |
Peptide sequence | MAFSLYSLQVAPLVSRQDRNSSFLSQNSDSNQKNKMHVSMAMQMDEASTNLHIFHNKVPHVLTVAGSDSGSGAGIQADLKACAAHRVYCSTVITAVTAQNTVGVQGVNIMPEDFVAEQLRSVLSDMHVDVVKTGMLPSLNILKVLCQNLREFPVKALVVDPVMVSTSGHVLVGPSILDGFRYVFF* |
ORF Type | complete |
Blastp | Thiamine biosynthetic bifunctional enzyme TH1, chloroplastic from Arabidopsis with 73.81% of identity |
---|---|
Blastx | Thiamine biosynthetic bifunctional enzyme TH1, chloroplastic from Arabidopsis with 73.81% of identity |
Eggnog | phosphomethylpyrimidine kinase(COG0351) |
Kegg | Link to kegg annotations (AT1G22940) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426094.1) |
Pfam | Phosphomethylpyrimidine kinase (PF08543.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer