Protein coding transcript 167937

• Transcript: Ll_transcript_182476
• CDS coordinates: 2-1120 (+)
• Peptide sequence: LKPENLLLDENGNLKVSDFGLSAVSDQMRQDGLFHTFCGTPAYVAPEVLTRRGYDGAKVDIWSCGVVLFVLMAGYLPFNDKNIMVMYRRIYKGDFRCPRWCSPQLSKFLAQLLVTNPETRIGIPEIMENKWFKKGFKQVKFYVEDDKVFNVDGSVVDNEDDVVSVASDYSVSESDSEIETRRRNAPLPRPASLNAFDIISFSKGFDLSGLFEEKGDETRFVTAAPVHKIISKLEEIAQLVSFSVRKKECRVSLEGTREGVKGPLTIAAEIFELTPTLVVVEVKKKGGDRAEYEKFCNTELKPGLEKLTAEESATSSFSAPPIKSHLLRVQSEPINMPSDIESPRYINSDIESPHYIPSDVESPIYMPSDSDT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_182476

• Blastp: CBL-interacting serine/threonine-protein kinase 12 from Arabidopsis with 69.19% of identity
• Blastx: CBL-interacting serine/threonine-protein kinase 12 from Arabidopsis with 72.96% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G18700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430554.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;