Transcript | Ll_transcript_180045 |
---|---|
CDS coordinates | 163-963 (+) |
Peptide sequence | MSKGTSSKLKIAIIHPDLGIGGAERLIVDAAVELASQGHKVHIFTAHHDKNRCFEETVSGNFPVTVYGSFLPRHIFYRLHALCAYLRCLFVSLCVLFMWPSFDVVLADQVSVVIPILKLKRSTKVVFYCHFPDLLLAQHSTFLRRMYRKPIDYVEEITSGMADLILVNSNFTASTFAKTFKHLNAKGIRPATLYPAVNVDQFSEPNSFKMTFLSINRFEKKKNIELAISAFSMLHSSEGVLKNQDVNASLVIAGLLLSGLGHGFKS* |
ORF Type | complete |
Blastp | Alpha-1,3/1,6-mannosyltransferase ALG2 from Rhizomucor with 47.53% of identity |
---|---|
Blastx | Alpha-1,3/1,6-mannosyltransferase ALG2 from Rhizomucor with 47.53% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456641.1) |
Pfam | Glycosyltransferase Family 4 (PF13439.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer