Protein coding transcript 167956

• Transcript: Ll_transcript_180048
• CDS coordinates: 267-1067 (+)
• Peptide sequence: MAKGTPSKSNIAIIHPDLGIGGAERLIVDAAVELASYGHKVHIFTAHHDKNRCFEETISGTFPVTVYGSFLPRHIFYRLHALCAYLRCLFVALCVLFMWPSFDVILVDQVSVVIPILKLKRSTKVVFYCHFPDLLLAQHSTFLRRMYRKPIDYVEEITSGMADLILVNSNFTASTFAKTFKHLNAKGIRPATLYPAVNVDQFSEPNSFKMTFLSINRFEKKKNIELAISAFSMLHSSEGVLKNQDVNASLVIAGLLLSGLGHGFKS*
• ORF Type: complete

Annotations of Ll_transcript_180048

• Blastp: Alpha-1,3/1,6-mannosyltransferase ALG2 from Rhizomucor with 48.85% of identity
• Blastx: Alpha-1,3/1,6-mannosyltransferase ALG2 from Rhizomucor with 44.83% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443872.1)
• Pfam: Glycosyltransferase Family 4 (PF13439.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;