Transcript | Ll_transcript_180823 |
---|---|
CDS coordinates | 1741-2298 (+) |
Peptide sequence | MQTSAFGKSKGLLKTLAEGNWSDAFDGLSISLLLTSNPAIQYTVFDQLKHRVLKNKPNRDGKTVSPASLSAFMAFLIGAISKSFATVITYPAIRCKVIIQAADSDEATSETKVKSQKTVPGVLYGIWKREGIFGFFKGLHAQILKTVLSSALLLMIKEKISATTWVLILAVKRYLLLPRAKIKNT* |
ORF Type | complete |
Blastp | Peroxisomal adenine nucleotide carrier 1 from Soja with 85.33% of identity |
---|---|
Blastx | Peroxisomal adenine nucleotide carrier 1 from Soja with 87.97% of identity |
Eggnog | peroxisomal membrane protein(ENOG410ZNC0) |
Kegg | Link to kegg annotations (100301879) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428054.1) |
Pfam | Mitochondrial carrier protein (PF00153.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer