Protein coding transcript 167972

• Transcript: Ll_transcript_180824
• CDS coordinates: 1163-1720 (+)
• Peptide sequence: MQTSAFGKSKGLLKTLAEGNWSDAFDGLSISLLLTSNPAIQYTVFDQLKHRVLKNKPNRDGKTVSPASLSAFMAFLIGAISKSFATVITYPAIRCKVIIQAADSDEATSETKVKSQKTVPGVLYGIWKREGIFGFFKGLHAQILKTVLSSALLLMIKEKISATTWVLILAVKRYLLLPRAKIKNT*
• ORF Type: complete

Annotations of Ll_transcript_180824

• Blastp: Peroxisomal adenine nucleotide carrier 1 from Soja with 85.33% of identity
• Blastx: Peroxisomal adenine nucleotide carrier 1 from Soja with 85.94% of identity
• Eggnog: peroxisomal membrane protein(ENOG410ZNC0)
• Kegg: Link to kegg annotations (100301879)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428054.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;