Transcript | Ll_transcript_180104 |
---|---|
CDS coordinates | 271-603 (+) |
Peptide sequence | MLEAEKTNGIGKTENEVLLNLKTLSQNGFEKVMIRNKLDAVVVPGPNFSRILAIGGYPGVIVPAGYEKGVPFGISFAGLKGSEPNLIEIAYSFEQATKIRKPPPLQKLRA* |
ORF Type | complete |
Blastp | Glutamyl-tRNA(Gln) amidotransferase subunit A from Candidatus Desulforudis with 39.66% of identity |
---|---|
Blastx | - |
Eggnog | Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA synthetase. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln) (By similarity)(COG0154) |
Kegg | Link to kegg annotations (Daud_1033) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431564.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer