Protein coding transcript 167998

• Transcript: Ll_transcript_180136
• CDS coordinates: 2958-3626 (+)
• Peptide sequence: MGLREKYEAHHKCRFTEDAIKAAVNLSSRYICDRYLPDKAIDLIDEAGSRAHIDDFKRKKELDNCVLLKSPTDYWQEIRDVQAMHEMESKLKYYGTSSIDDTSELIVDSYLPSEANDNEPVVVGPEDIATVASIWSGIPVQQLSVDQRTLLLDLNNQLRKRVIGQDEAVLAISRAVKRSRVGLKDPDRPIAAMLFCGPTGVGKTELAKSLAACYFGSVRFYT*
• ORF Type: complete

Annotations of Ll_transcript_180136

• Blastp: Chaperone protein ClpD, chloroplastic from Arabidopsis with 69.09% of identity
• Blastx: Chaperone protein ClpD, chloroplastic from Arabidopsis with 69.6% of identity
• Eggnog: ATP-dependent CLP protease ATP-binding subunit(COG0542)
• Kegg: Link to kegg annotations (AT5G51070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429737.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;