Transcript | Ll_transcript_180119 |
---|---|
CDS coordinates | 1251-2294 (+) |
Peptide sequence | MFLQTKRIMSLDVAMLMAGAKERGELEERVTKLIKEIIKSGDVILFIDEVHTLVQSGTSGKGNKGSGLDISNLLKPALGRGQFQCIASTTIDEYRLHFEKDKALARRFQPVWVDEPSEDDAVKILMGLREKYEAHHKCRFTEDAIKAAVNLSSRYICDRYLPDKAIDLIDEAGSRAHIDDFKRKKELDNCVLLKSPTDYWQEIRDVQAMHEMESKLKYYGTSSIDDTSELIVDSYLPSEANDNEPVVVGPEDIATVASIWSGIPVQQLSVDQRTLLLDLNNQLRKRVIGQDEAVLAISRAVKRSRVGLKDPDRPIAAMLFCGPTGVGKTELAKSLAACYFGSVRFYT* |
ORF Type | complete |
Blastp | Chaperone protein ClpD, chloroplastic from Arabidopsis with 72.67% of identity |
---|---|
Blastx | Chaperone protein ClpD, chloroplastic from Arabidopsis with 72.67% of identity |
Eggnog | ATP-dependent CLP protease ATP-binding subunit(COG0542) |
Kegg | Link to kegg annotations (AT5G51070) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429737.1) |
Pfam | ATPase family associated with various cellular activities (AAA) (PF00004.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer