Protein coding transcript 168080

• Transcript: Ll_transcript_181779
• CDS coordinates: 1422-1814 (+)
• Peptide sequence: MVTPGSESAKVAPEVIAEHTVRALLRTVPAAVPAIVFLSGGQSEEEATVNLNAMNKLKGKKPWSLTFSYGRALQQSTLKAWGGKDENIPKAQATLLTRCKANSQATLGTYKGDANLEGATESLHVKDYKY*
• ORF Type: complete

Annotations of Ll_transcript_181779

• Blastp: Fructose-bisphosphate aldolase 6, cytosolic from Arabidopsis with 85.5% of identity
• Blastx: Fructose-bisphosphate aldolase 6, cytosolic from Arabidopsis with 87.55% of identity
• Eggnog: fructose-bisphosphate aldolase(COG3588)
• Kegg: Link to kegg annotations (AT2G36460)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442975.1)
• Pfam: Fructose-bisphosphate aldolase class-I (PF00274.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;