Protein coding transcript 168118

• Transcript: Ll_transcript_180581
• CDS coordinates: 236-583 (+)
• Peptide sequence: MLRLVAKRLLGTPTASPTVRVPPRFYHERVVDHYNNPRNVGSFDKNDPTVGTGLVGAPACGDVMKLQIRVDDKTGKIVDARFKTFGCGSAIASSSVATEWVKGKQMEEVLSIKNT*
• ORF Type: complete

Annotations of Ll_transcript_180581

• Blastp: Iron-sulfur cluster assembly protein 1 from Arabidopsis with 75.21% of identity
• Blastx: Iron-sulfur cluster assembly protein 1 from Arabidopsis with 75.21% of identity
• Eggnog: sUF system Fes assembly protein, NifU family(COG0822)
• Kegg: Link to kegg annotations (AT4G22220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462763.1)
• Pfam: NifU-like N terminal domain (PF01592.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;