Transcript | Ll_transcript_180577 |
---|---|
CDS coordinates | 236-724 (+) |
Peptide sequence | MLRLVAKRLLGTPTASPTVRVPPRFYHERVVDHYNNPRNVGSFDKNDPTVGTGLVGAPACGDVMKLQIRVDDKTGKIVDARFKTFGCGSAIASSSVATEWVKGKQMEEVLSIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKRAKATTTAEKAANA* |
ORF Type | complete |
Blastp | Iron-sulfur cluster assembly protein 1 from Arabidopsis with 77.22% of identity |
---|---|
Blastx | Iron-sulfur cluster assembly protein 1 from Arabidopsis with 79.73% of identity |
Eggnog | sUF system Fes assembly protein, NifU family(COG0822) |
Kegg | Link to kegg annotations (AT4G22220) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462763.1) |
Pfam | NifU-like N terminal domain (PF01592.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer