Transcript | Ll_transcript_182692 |
---|---|
CDS coordinates | 550-867 (+) |
Peptide sequence | MVKLAEKCNIQVPMEVLNLIDDGKNPDEFTKDVLNNCIAKNQITKGKTDAMKNFRKHLLEELEETFPAEVETFRESRAASAAELKRLAQAQSVLPNGDVRVKGEH* |
ORF Type | complete |
Blastp | Mediator of RNA polymerase II transcription subunit 10b from Arabidopsis with 76.92% of identity |
---|---|
Blastx | Mediator of RNA polymerase II transcription subunit 10b from Arabidopsis with 66.67% of identity |
Eggnog | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors(ENOG4111QA2) |
Kegg | Link to kegg annotations (AT1G26665) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004504338.1) |
Pfam | Transcription factor subunit Med10 of Mediator complex (PF09748.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer