Transcript | Ll_transcript_182340 |
---|---|
CDS coordinates | 656-1540 (+) |
Peptide sequence | MLFTWYAPILTTSLFLSLFSYKESTIEKKRSVGIIIIYYMAFLDDTLCVKGEVVKDWREIVTYFSYPIGKRDYSRWPEKPEGWIKVTEEYSEKLMNLACKLLEVLSEAMGLEKEALTKACIDMDQKVVVNYYPKCPQPDLTLGLKRHTDPGTITLLVQDQVGGLQATRDDGKTWITVQPIQGAFIVNLGDHGHYLSNGRFKNADHQAVVNSNCSRLSIATFQNPAPEAKVYPLMVREGDKPILKEPISFSEMYKMKMNKDIEISRLKKVAKEKKQLQNINKDKLETKPIEEILA* |
ORF Type | complete |
Blastp | Naringenin,2-oxoglutarate 3-dioxygenase from Petunia with 80.32% of identity |
---|---|
Blastx | Naringenin,2-oxoglutarate 3-dioxygenase from Petunia with 80.32% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420370.1) |
Pfam | 2OG-Fe(II) oxygenase superfamily (PF03171.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer