Protein coding transcript 168259

• Transcript: Ll_transcript_181166
• CDS coordinates: 2-361 (+)
• Peptide sequence: VKNGSVCCLDVQSGVAYLKKAMHMFPNCNLMRNLLGYLLLSSKELNDCHVAIRCCKLGHLDLSDEEGLKSAFDIHGAGAVACYATSNSSPKFTFPTCTMQCSSHSGAIRYLQKSFHQKPW
• ORF Type: internal

Annotations of Ll_transcript_181166

• Blastp: Tetratricopeptide repeat protein SKI3 from Arabidopsis with 42.02% of identity
• Blastx: Tetratricopeptide repeat protein SKI3 from Arabidopsis with 42.02% of identity
• Eggnog: Tetratricopeptide repeat domain 37(ENOG410ZG1H)
• Kegg: Link to kegg annotations (AT1G76630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423132.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;