Protein coding transcript 168263

• Transcript: Ll_transcript_181172
• CDS coordinates: 2-409 (+)
• Peptide sequence: VKNGSVCCLDVQSGVAYLKKAMHMFPNCNLMRNLLGYLLLSSKELNDCHVAIRCCKLGHLDLSDEEGLKSAFDIHGAGAVACYATSNSSPKFTFPTCTMQCSSHSGAIRYLQKYYFSFPLCPVTAQKLKSYYIAV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_181172

• Blastp: Tetratricopeptide repeat protein SKI3 from Arabidopsis with 40.34% of identity
• Blastx: Tetratricopeptide repeat protein SKI3 from Arabidopsis with 40.34% of identity
• Eggnog: Tetratricopeptide repeat domain 37(ENOG410ZG1H)
• Kegg: Link to kegg annotations (AT1G76630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423132.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;