Protein coding transcript 168272

• Transcript: Ll_transcript_181427
• CDS coordinates: 270-599 (+)
• Peptide sequence: MAKPGVLDSDPVMMVKKTIELKKKELKRLVKSILDDDDFSIEIIDQAKEALCVIKDLKMRKSSSSSSSLCLKLQKNVTCPDEFKCPLSKELMRDPVIVASGQVRVRIWSK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_181427

• Blastp: U-box domain-containing protein 9 from Arabidopsis with 50.49% of identity
• Blastx: U-box domain-containing protein 9 from Arabidopsis with 43.69% of identity
• Eggnog: U-box domain-containing protein(ENOG410XRTN)
• Kegg: Link to kegg annotations (AT3G07360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414203.1)
• Pfam: U-box domain (PF04564.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;