Protein coding transcript 168294

• Transcript: Ll_transcript_181736
• CDS coordinates: 511-948 (+)
• Peptide sequence: MHNIADLLKESKGDVQKESIELNIEELKTLLSKVDSQMKFLPATAQVASQQGTYLAKCFNRMEECEKNPEGPLRYRGEGRHRFKPFRYRHLGQFAPLGGEQTAAQLPGDWVSIGQSSQWLWYSVYARYGVPFVVPRPVSSHVPEQ*
• ORF Type: complete

Annotations of Ll_transcript_181736

• Blastp: External alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial from Arabidopsis with 81.89% of identity
• Blastx: External alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial from Arabidopsis with 79.65% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT4G05020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431453.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;