Protein coding transcript 168298

• Transcript: Ll_transcript_181719
• CDS coordinates: 151-600 (+)
• Peptide sequence: MHNFTFFQRVSKAFRNHDSHIKLLLLCTTVTVSGGGLLAYGDAVAASEAALVTEKKKVVVLGTGWAGTSFLKNLNNPKYDVHVVSPRNYFTFTPLLPSVTCGTVEARSIVEPIRNIFRKVIIKTSKFLPIPYWAIMNLLISFRKIFTNH*
• ORF Type: complete

Annotations of Ll_transcript_181719

• Blastp: External alternative NAD(P)H-ubiquinone oxidoreductase B2, mitochondrial from Arabidopsis with 64.8% of identity
• Blastx: External alternative NAD(P)H-ubiquinone oxidoreductase B1, mitochondrial from Solanum with 69.28% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT4G05020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431453.1)
• Pfam: Pyridine nucleotide-disulphide oxidoreductase (PF07992.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;