Protein coding transcript 168317

• Transcript: Ll_transcript_182107
• CDS coordinates: 2381-2752 (+)
• Peptide sequence: MEKILERHERYAYAERQLVANDSETQGNWTIEYTRLKAKIDLLQRNHRHYMGEDLGSMSLKELQSLEQQLETALKTIRTRRNQLMYESISELQKKEKVIQEQNNMLAKKIKEKEKANAAQQAAP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_182107

• Blastp: Floral homeotic protein APETALA 1 from Arabidopsis with 72.73% of identity
• Blastx: Floral homeotic protein APETALA 1 from Citrus with 74.07% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (ARALYDRAFT_476039)
• CantataDB: Link to cantataDB annotations (CNT0000849)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443748.1)
• Pfam: K-box region (PF01486.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;