Protein coding transcript 168319

• Transcript: Ll_transcript_182110
• CDS coordinates: 1-489 (+)
• Peptide sequence: GRGRVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYATDSCMEKILERHERYAYAERQLVANDSETQGNWTIEYTRLKAKIDLLQRNHRHYMGEDLGSMSLKELQSLEQQLETALKTIRTRRNQLMYESISELQKKEKVIQEQ
• ORF Type: internal

Annotations of Ll_transcript_182110

• Blastp: Floral homeotic protein APETALA 1 from Arabidopsis with 83.44% of identity
• Blastx: Floral homeotic protein APETALA 1 from Arabidopsis with 83.44% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT1G69120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443748.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;