Protein coding transcript 168320

• Transcript: Ll_transcript_182112
• CDS coordinates: 2382-2747 (+)
• Peptide sequence: MEKILERHERYAYAERQLVANDSETQGNWTIEYTRLKAKIDLLQRNHRHYMGEDLGSMSLKELQSLEQQLETALKTIRTRRNQLMYESISELQKKEKVIQEQNNMLAKKVNKSAIIFFGFI*
• ORF Type: complete

Annotations of Ll_transcript_182112

• Blastp: Floral homeotic protein APETALA 1 from Citrus with 70.94% of identity
• Blastx: Floral homeotic protein APETALA 1 from Citrus with 69.75% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000849)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014624024.1)
• Pfam: K-box region (PF01486.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;