Protein coding transcript 168321

• Transcript: Ll_transcript_182113
• CDS coordinates: 1-306 (+)
• Peptide sequence: GRGRVQLKRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALIVFSHKGKLFEYATDSCMEKILERHERYAYAERQLVANDSETQVRVIRFIYSLYIHK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_182113

• Blastp: Floral homeotic protein APETALA 1 A from Brassica with 86.36% of identity
• Blastx: Floral homeotic protein APETALA 1 A from Brassica with 88.37% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443748.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;