Protein coding transcript 168323

• Transcript: Ll_transcript_182096
• CDS coordinates: 2381-2746 (+)
• Peptide sequence: MEKILERHERYAYAERQLVANDSETQGNWTIEYSRLKAKIELLQTNHRHYMGEDLGSMSLKELQSLEQQLDTALKTIRTRRNQLMYESISELQKKEKVIQEQNNMLAKKVNKSAIIFFGFI*
• ORF Type: complete

Annotations of Ll_transcript_182096

• Blastp: Floral homeotic protein APETALA 1 from Citrus with 71.79% of identity
• Blastx: Floral homeotic protein APETALA 1 from Citrus with 70.59% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000849)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461014.1)
• Pfam: K-box region (PF01486.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;