Protein coding transcript 168326

• Transcript: Ll_transcript_182099
• CDS coordinates: 219-710 (+)
• Peptide sequence: MGRGRVQLKRIENNINRQVTFSKRRAGLLKKANEISVLCDAEVALIVFSHKGKLFEYATDSCMEKILERHERYAYAERQLVANDSETQGNWTIEYSRLKAKIELLQTNHRHYMGEDLGSMSLKELQSLEQQLDTALKTIRTRRNQLMYESISELQKKEKVIQEQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_182099

• Blastp: Floral homeotic protein APETALA 1 from Arabidopsis with 82.93% of identity
• Blastx: Floral homeotic protein APETALA 1 from Arabidopsis with 82.93% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT1G69120)
• CantataDB: Link to cantataDB annotations (CNT0000849)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461014.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;