Transcript | Ll_transcript_180987 |
---|---|
CDS coordinates | 68-823 (+) |
Peptide sequence | MNKLNICSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMRMQKRYGKIDTSGALTEKEIIRAERNSGVISNRVREIQMQNYLRKREQKESRERDLREGLVLYRNAKYEEALEKFESVLGTKPEPEEAAVASYNVACCYSKLNQIQAALSSLEEALNAGFEDFKRIRTDPDLANARASEEFDPLVKRFDESFINENAINAIKSLFGFGIKGDYQNHFCPAQFVHMQFCPCQHTPAHGPGSGTGHAAPSADTGHAQ |
ORF Type | 3prime_partial |
Blastp | Protein MET1, chloroplastic from Arabidopsis with 77.11% of identity |
---|---|
Blastx | Protein MET1, chloroplastic from Arabidopsis with 74.52% of identity |
Eggnog | NA(ENOG410ZEH3) |
Kegg | Link to kegg annotations (AT1G55480) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444205.1) |
Pfam | Tetratricopeptide repeat (PF13432.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer