Protein coding transcript 1684

• Transcript: Ll_transcript_530975
• CDS coordinates: 2-664 (+)
• Peptide sequence: PLCRDKVDLEDGVLIDQPHLPPPSLIRHQSNAHNEGFDINNTPQPRLQSQNPNQVISRRHSWVGKSENGVIEINLEDIEETRSHRRSLDDSVVRRIEGKRKDGKLVTHENKRSKKREKDHRLEHRIIVSSPTTKPSQCTSVYQKRWSNIEPCDLLCLTPDMIISENYTRTASSSSQQQHQNRRVSLPFFIRNQNVEDEMEKGGMNMNMRTVSETTGMNGNR
• ORF Type: internal

Annotations of Ll_transcript_530975

• Blastp: RING-H2 finger protein ATL43 from Arabidopsis with 29.95% of identity
• Blastx: RING-H2 finger protein ATL43 from Arabidopsis with 31.07% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT5G05810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460717.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;