Protein coding transcript 168405

• Transcript: Ll_transcript_180984
• CDS coordinates: 259-1227 (+)
• Peptide sequence: MSLSTTTSGHSSLYSALTLPRTTIIHNKLFSPTTKFYSSRNHTYSGVSSCFSNTLLLKKFPFVVRASSSSSSEVGSEASKQENGEKSEGGEESYEEYEVEIEQPYGLRFVKGRDGGTYIDAIAPGGSADKVGVFSVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMRMQKRYGKIDTSGALTEKEIIRAERNSGVISNRVREIQMQNYLRKREQKESRERDLREGLVLYRNAKYEEALEKFESVLGTKPEPEEAAVASYNVACCYSKLNQIQAALSSLEEALNAGFEDFKVINLLNFIHHILSKLAKPPKILLFF*
• ORF Type: complete

Annotations of Ll_transcript_180984

• Blastp: Protein MET1, chloroplastic from Arabidopsis with 65.91% of identity
• Blastx: Protein MET1, chloroplastic from Arabidopsis with 70.57% of identity
• Eggnog: NA(ENOG410ZEH3)
• Kegg: Link to kegg annotations (AT1G55480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444205.1)
• Pfam: Tetratricopeptide repeat (PF13432.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;