Protein coding transcript 16841

• Transcript: Ll_transcript_277359
• CDS coordinates: 72-1175 (+)
• Peptide sequence: MAGLQRRRRQCPLFAEMGPVYIFKEPIGLEKMARLASRGGDIVPSFGNAAGIPWLATNAHVQSKAEESVLLDAEIGGFIHLLYHPSLLSGRFCPDASPSGAAGTLRRPAEVLGQVHVATRMRPVDTLWALAYGGPLSLLPLAISSVHEETLEPQQGNFSVAAATTCLAASIFRIISVAIQHPRNNEDLSHGKGPEILSKILNYLLQTLSSLDIGKHDGVRDEELVAAVVSLCQSQKINHMLKVQLFTTLLLDLKIWSLCSYGIQKKLLSSLADMVFTESTVMRDANAIQMLIDGCRRCYWTVPEKDSVNTFSLTGATRPVGEVNALVDELLVVIELLIVAASPLVASDDVRCLLGFMADCPQPNQVN*
• ORF Type: complete

Annotations of Ll_transcript_277359

• Blastp: BEACH domain-containing protein C2 from Arabidopsis with 74.93% of identity
• Blastx: BEACH domain-containing protein C2 from Arabidopsis with 75.64% of identity
• Eggnog: beige BEACH domain containing protein(ENOG410XNQC)
• Kegg: Link to kegg annotations (AT2G45540)
• CantataDB: Link to cantataDB annotations (CNT0001256)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431479.1)
• Pfam: Domain of unknown function (DUF4704) (PF15787.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;