Protein coding transcript 168476

• Transcript: Ll_transcript_179957
• CDS coordinates: 158-922 (+)
• Peptide sequence: MKNPPPPRSAGISPDTEEIGWEMRPNGMFVQKREVGSVHDGPMINITVTHSSSNLELYLPNQSTFWDVKKLLAHKTGLRSEEQRLFFKGKEMDDEDHLHKEGVKDKSKLLLLEDASSEERTLEEFRKHNKMLKAFEAVAGVRAEVDKLSDWVSALEVAVDGGTRVSDKEFIVCTELLMRQLLKLDGIEAEGEPKLQRKAEVRLVQNLVATLDSLKERNSNPFNRSGKAISVTTQWENFNTKMRSFNAPTSTSKM*
• ORF Type: complete

Annotations of Ll_transcript_179957

• Blastp: BAG family molecular chaperone regulator 4 from Arabidopsis with 47.54% of identity
• Blastx: BAG family molecular chaperone regulator 4 from Arabidopsis with 47.54% of identity
• Eggnog: BCL-2-associated athanogene(ENOG4111WNH)
• Kegg: Link to kegg annotations (AT3G51780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450352.1)
• Pfam: Ubiquitin-like domain (PF14560.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;