| Transcript | Ll_transcript_297630 |
|---|---|
| CDS coordinates | 1-369 (+) |
| Peptide sequence | EKEKLGRCEQFFLELMKVPRVESKLRVFSFKIEFHSQVSDLRNSLHVVNAASEEIRNSVKLKRIMQTILSLGNALNQGTAKGSAIGFRLDSLLKLTETRSRNNKITLMHYLCKVLADKLPEVL |
| ORF Type | internal |
| Blastp | Formin-like protein 17 from Arabidopsis with 78.69% of identity |
|---|---|
| Blastx | Formin-like protein 17 from Arabidopsis with 78.69% of identity |
| Eggnog | actin cytoskeleton organization(ENOG410XT5Z) |
| Kegg | Link to kegg annotations (AT3G32400) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019414354.1) |
| Pfam | Formin Homology 2 Domain (PF02181.22) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer