Protein coding transcript 16854

• Transcript: Ll_transcript_276317
• CDS coordinates: 117-578 (+)
• Peptide sequence: MITKMKLLVVICVVLLIHFCFVNAEPSLSVDGKVLVLDESNFESAISSFDHILVDFYAPWCGHCKRLSPELDAAAPVLAALKNPIVIAKVDADKFTRLAKKYDVEYDSVILFITRLNNLYCLLTVLLVLLSLFHQLRLTNAFYSVVQCISNHFV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_276317

• Blastp: Protein disulfide-isomerase 5-2 from Arabidopsis with 68.35% of identity
• Blastx: Protein disulfide-isomerase 5-2 from Arabidopsis with 68.35% of identity
• Eggnog: Thioredoxin(COG0526)
• Kegg: Link to kegg annotations (AT1G35620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427760.1)
• Pfam: Thioredoxin (PF00085.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;