Protein coding transcript 168550

• Transcript: Ll_transcript_262911
• CDS coordinates: 306-794 (+)
• Peptide sequence: MLKFMQELRKVVTIGVVGGSDFVKISEQLGNTVTNDYDYVFSENGLLAHKEGKLIGIQSLKDFIGEEKLKEIINFTLHYIADLDIPIKRGTFIEFRSGMLNVSPIGRNCSQEERDEFEKYDKVQNIRSKMVSVLREKFAHLNLTFSIGGQISFDVCNVFIFW*
• ORF Type: complete

Annotations of Ll_transcript_262911

• Blastp: Phosphomannomutase from Oryza sativa with 85.16% of identity
• Blastx: Phosphomannomutase from Oryza sativa with 85.71% of identity
• Eggnog: ,hydrolase(COG0561)
• Kegg: Link to kegg annotations (4337437)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426444.1)
• Pfam: Eukaryotic phosphomannomutase (PF03332.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;