Transcript | Ll_transcript_262892 |
---|---|
CDS coordinates | 814-1278 (+) |
Peptide sequence | MAARIPGLIALFDVDGTLTAPRKVVTPEMLKFMQELRKVVTIGVVGGSDFVKISEQLGNTVTNDYDYVFSENGLLAHKEGKLIGIQSLKDFIGEEKLKEIINFTLHYIADLDIPIKRGTFIEFRSGMLNVSPIGRNCSQEERDEFEKLQPRRKR* |
ORF Type | complete |
Blastp | Phosphomannomutase from Soja with 92.52% of identity |
---|---|
Blastx | Phosphomannomutase from Soja with 92.52% of identity |
Eggnog | ,hydrolase(COG0561) |
Kegg | Link to kegg annotations (732605) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426444.1) |
Pfam | haloacid dehalogenase-like hydrolase (PF08282.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer