Protein coding transcript 168563

• Transcript: Ll_transcript_262919
• CDS coordinates: 632-1285 (+)
• Peptide sequence: MLADSESAESYNENDPRSSSSQISSSSQLPSSSTLGQYIPTLTRLKEKLSGFWLHTIQRWPAMLPIVRELLQLLLRANLMLFYFEGLYYHISKRAASIRYVFIGKASNQRPRYQILGVFLLIQLCVIAAEGLRRRNLTSITGSVNQASFATYHRSPGHDLPVLNEEGSLASPDADKGTLVSESSSPEVQFTPFLLVIIIFSVQLLLSWKSICDICFT*
• ORF Type: complete

Annotations of Ll_transcript_262919

• Blastp: Peroxisome biogenesis factor 10 from Arabidopsis with 58.15% of identity
• Blastx: Peroxisome biogenesis factor 10 from Arabidopsis with 51.47% of identity
• Eggnog: Peroxisomal biogenesis factor 10(COG5574)
• Kegg: Link to kegg annotations (AT2G26350)
• CantataDB: Link to cantataDB annotations (CNT0002111)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422334.1)
• Pfam: Pex2 / Pex12 amino terminal region (PF04757.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;