Protein coding transcript 168567

• Transcript: Ll_transcript_262895
• CDS coordinates: 3-356 (+)
• Peptide sequence: EHMSSLIWLLCRYQILGVFLLIQLCVIAAEGLRRRNLTSITGSVNQASFATYHRSPGHDLPVLNEEGSLASPDADKGTLVSESSSPEVQFTPFLLVIIIFSVQLLLSWKSICDICFT*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_262895

• Blastp: Peroxisome biogenesis factor 10 from Arabidopsis with 62.82% of identity
• Blastx: Peroxisome biogenesis factor 10 from Arabidopsis with 62.82% of identity
• Eggnog: Peroxisomal biogenesis factor 10(COG5574)
• Kegg: Link to kegg annotations (AT2G26350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422334.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;