Protein coding transcript 168627

• Transcript: Ll_transcript_262990
• CDS coordinates: 207-689 (+)
• Peptide sequence: MIFGGTIQGWWNDLRMWLYKGTSSYLFAFIDNILKFFGLSDSPFTITTKIMDEDVCQRYENEVMEFGASSPFFTILATLALFNLFCLLSTLKELVLGEDGFRVYEEMVLQILLCGFLVFINFPIYQGLFLRKDKGRLPTSLVIKSTALALGACIISKILT*
• ORF Type: complete

Annotations of Ll_transcript_262990

• Blastp: Cellulose synthase-like protein E6 from Oryza sativa with 43.87% of identity
• Blastx: Cellulose synthase-like protein E1 from Arabidopsis with 49.44% of identity
• Eggnog: cellulose synthase-like protein(ENOG410Y931)
• Kegg: Link to kegg annotations (9269152)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435697.1)
• Pfam: Cellulose synthase (PF03552.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;