| Transcript | Ll_transcript_297639 |
|---|---|
| CDS coordinates | 2-445 (+) |
| Peptide sequence | FLSLAQVPLLSSAPLALYITSTIMHLVSSLAGLAAVSGIAAAQNYNDWSQEDVNSGKAWSDVSNTANDRMRDNVNSRNGQCNYDNAQVRKEWRNMAKEERKSFTDAVQCLHHIPYQRMTDAQKVDYPGVFTRYDEYVATHIQFTEKIH |
| ORF Type | internal |
| Blastp | Tyrosinase-like protein orsC from Aspergillus with 36.99% of identity |
|---|---|
| Blastx | Tyrosinase-like protein orsC from Aspergillus with 36.99% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (AN7912.2) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_014504394.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer