Transcript | Ll_transcript_262642 |
---|---|
CDS coordinates | 237-710 (+) |
Peptide sequence | MKNLPQGYRPNVGVCLINSEDQVFVASRLNVPGAWQMPQGGIEDGEEPKSAAIRELREETGIISAEIIAEVENWLTYDFPPAVKAKVSRLWGGEWHGQAQKWFLMRLTKDDSEINLANGEADPEFAEWKWTNPEEVIEQVSRKILVSKISTFLFLKD* |
ORF Type | complete |
Blastp | Nudix hydrolase 25 from Arabidopsis with 74.23% of identity |
---|---|
Blastx | Nudix hydrolase 25 from Arabidopsis with 71.35% of identity |
Eggnog | Nudix hydrolase(COG0494) |
Kegg | Link to kegg annotations (AT1G30110) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432217.1) |
Pfam | NUDIX domain (PF00293.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer