Protein coding transcript 1688

• Transcript: Ll_transcript_297649
• CDS coordinates: 49-666 (+)
• Peptide sequence: MSSTIVSKSSNSKGLFSNKNFFFKLSFPCLTNRSKPKPLPPSDINDTTTPPLIMAYVNNNMYNNDVKFKDVFEHLDVDKDGKISSKELVDYFASVGESMNHRVAKSVVNEFDSDGDEFLDFEDFVKLMKEENNDELENILRSAFEMFEVEKGSGCITPKGLQQMLKQLGDVKSHDECAAMIRAFDLDGNGFLDFHEFQHMMSLAT*
• ORF Type: complete

Annotations of Ll_transcript_297649

• Blastp: Probable calcium-binding protein CML41 from Arabidopsis with 45.97% of identity
• Blastx: Probable calcium-binding protein CML41 from Arabidopsis with 48.84% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (AT3G50770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438013.1)
• Pfam: EF-hand domain (PF13405.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;